Scaffold Ga0151620_1030065

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0151620_1030065

Scaffold Ga0151620_1030065

Overview

Basic Information
Taxon OID	3300011268 Open in IMG/M
Scaffold ID	Ga0151620_1030065 Open in IMG/M
Source Dataset Name	Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1857
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → The Molecular Ecology Of Microcystis Sp. Blooms In The San Francisco Estuary Delta

Source Dataset Sampling Location
Location Name	San Francisco Estuary Delta, California, USA
Coordinates	Lat. (^o)	37.986944	Long. (^o)	-121.523611	Alt. (m)		Depth (m)	.2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052416	Metagenome / Metatranscriptome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151620_10300652	F052416	GGAG	MYTSPKIITSPISGQPVKPLIKSYITGNKEITEAHYIDPASGAFIRKGIISVKDLKTGQMVDTSI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.