NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137391_10054258

Scaffold Ga0137391_10054258


Overview

Basic Information
Taxon OID3300011270 Open in IMG/M
Scaffold IDGa0137391_10054258 Open in IMG/M
Source Dataset NameVadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3422
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008075Metagenome / Metatranscriptome339N
F009595Metagenome315Y
F013400Metagenome / Metatranscriptome271N

Sequences

Protein IDFamilyRBSSequence
Ga0137391_100542582F009595GAGGLRSEIIETFQATIVQCFSQTIENLFGRPVKEQLMRILAEHKIPRTEIGARFDDVARVLNEVFGSSSRLLVFKTVVELYEEYSVRASFGFYDSLKDQILYLREKVLGDIIKPRHSPTIDDSIYIAGPRAIS*
Ga0137391_100542583F008075GGTGGMKSLLDPGRDIRESREFANTFQLSVTEGLVNTLGAIVMQTLKTVLSYSLETYADRPSELHRELSRVFGSGATTLERMITKELFQRLSLRYSNELDFETSVNLARRDTILSERGNN*
Ga0137391_100542586F013400AGGAGMADVTLLTGMWMVAVLQLALEAGIVLYAYRLTKLTGSFRAWTMIILAFVLTTASSFFGIILLLLNPDLIAGLVQSISLPTLIASYAISIATSLLFFFGVFDLVRRFKLAAKKPPSANPSTF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.