Scaffold Ga0138371_1050219

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138371_1050219

Scaffold Ga0138371_1050219

Overview

Basic Information
Taxon OID	3300011306 Open in IMG/M
Scaffold ID	Ga0138371_1050219 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 DCM_B metaT (Metagenome Metatranscriptome) (version 2)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	844
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location Name	Southern Atlantic ocean
Coordinates	Lat. (^o)	-28.2362	Long. (^o)	-38.4949	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001026	Metagenome / Metatranscriptome	802	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138371_10502191	F001026	GAG	MVMAKHTLELDDLELTALITHLEGQSEMMVESRLNCSNPRELPDREEVLLNLVYAKAFTIGWDAHINPKVDFNLHQNEDRIFKYK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.