Basic Information | |
---|---|
Taxon OID | 3300011318 Open in IMG/M |
Scaffold ID | Ga0138397_1131353 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Southern Atlantic ocean - KN S19 AAIW_A metaT (Metagenome Metatranscriptome) (version 2) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 616 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -28.2362 | Long. (o) | -38.4949 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003733 | Metagenome / Metatranscriptome | 471 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0138397_11313531 | F003733 | N/A | AGSSDFSGVWIAGHAELNVVAIDGTNTDGTGTDAASVTSGTIGGFAPTAGYEAGFNFPLGDTFFITVGFADGGGDSAQIAGATSDDGNSDVTLHASNPSWYYIAPSISIFDNSAVYFKYGQAHAELKALGDVAGGPDNLEGDLWGIGTTSIANNGLFFKTEAGAIQYGQFKIKGIGGSGLATLEGNPLVGYGHVSIGYKF* |
⦗Top⦘ |