NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153697_1407

Scaffold Ga0153697_1407


Overview

Basic Information
Taxon OID3300011334 Open in IMG/M
Scaffold IDGa0153697_1407 Open in IMG/M
Source Dataset NameLotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)13477
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (57.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameDaesunglee, Gyeonggi-do, South Korea
CoordinatesLat. (o)37.6746111Long. (o)127.3841278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024499Metagenome / Metatranscriptome205N
F044969Metagenome153N

Sequences

Protein IDFamilyRBSSequence
Ga0153697_140714F024499N/AMSEFTECLKESLAALYEQTGTAATIGSTSVTGILSTTTRKEAVELGGFDLDLNSTFTIDVANMATAPTIGSVLVANSVSFRIVTLDTSIGSYVLGLREF*
Ga0153697_14073F044969GAGMSASLTVNPAKLQKALNAFVGSTKLQAAKEMRIQARMLCVSLANSTQPFGLNARAKALGEKAVTTDINRVYKSGPTAVREIAALPLPRGRTKTQNAKQAAAALAALMLGKTFGKGKKAAQTHGKARELLGRINHKPYIYTEIGDFDRGAKHASARYGKSKRVPKNQYVRQVVTKESDLAKYFKEKRGNVGIAKSGWAVCAGILGGFKGIPKWVYRHTGGGRVQDRSQTKAGVFSKPYISMTNTIPWISNVISKTTVQRSIDIQVIKMIKRLSIIANYERKKAGL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.