NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153698_1293

Scaffold Ga0153698_1293


Overview

Basic Information
Taxon OID3300011335 Open in IMG/M
Scaffold IDGa0153698_1293 Open in IMG/M
Source Dataset NameLotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)21966
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameHwacheon, Gangwon-do, South Korea
CoordinatesLat. (o)38.0874861Long. (o)127.761456Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002322Metagenome / Metatranscriptome571Y
F002542Metagenome / Metatranscriptome550Y

Sequences

Protein IDFamilyRBSSequence
Ga0153698_129316F002542AGGAMHPSYLGFQIDWPVFVKVPFVADGKQLKRGDHFNWVGMHNVTEEKVATLYAAGFIYHNRELEVQNKVGDRLSEMNGQKLASLVNLLNAEVKSRTSSTTEFERKRCKKSTLDDKQRALIRRFLLSNTWITEDFYRIRDKLLGE*
Ga0153698_129326F002322AGGMPEKLPYSKLVEKHILECIQGGVGIRQMIASMQHLAQAPKSLSTMYKTYGNFIEAERAKINGQVGKKVIDQALAGDFKSQELFLRSKGGWSPTHTVNEVEQDVDPELDESAIDTLMGLLGLNDQEEK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.