NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153703_1219

Scaffold Ga0153703_1219


Overview

Basic Information
Taxon OID3300011336 Open in IMG/M
Scaffold IDGa0153703_1219 Open in IMG/M
Source Dataset NameLotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)21209
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameHanam-si, Gyeonggi-do, South Korea
CoordinatesLat. (o)37.5415972Long. (o)127.243111Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000843Metagenome / Metatranscriptome864Y

Sequences

Protein IDFamilyRBSSequence
Ga0153703_12195F000843N/AMALYQVLSNELPKIWPIAAPMLQRAIDLEPEAITIEQVEYSIRTGRVFLLVWDEPEEGITGAVTVEFIDYPRERVAHVNLMGGKGIVRQHVFDEAKNWMRSFGATKAQCWARGTLVQMYEKMGMTNTHQVMRTEL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.