Scaffold Ga0153700_11315

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0153700_11315

Scaffold Ga0153700_11315

Overview

Basic Information
Taxon OID	3300011339 Open in IMG/M
Scaffold ID	Ga0153700_11315 Open in IMG/M
Source Dataset Name	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chunlab, Inc
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	10552
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (88.89%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location Name	Seoul, South Korea
Coordinates	Lat. (^o)	37.5254611	Long. (^o)	127.0168945	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033006	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153700_113154	F033006	AGG	MKWVENNFFDHLDKFGNSLGYDNFGIAVCLSMVPWQSPEDRDVFIMTLTGVDVKGGEPSTFNPGSAVM*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.