Scaffold Ga0151652_13034722

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0151652_13034722

Scaffold Ga0151652_13034722

Overview

Basic Information
Taxon OID	3300011340 Open in IMG/M
Scaffold ID	Ga0151652_13034722 Open in IMG/M
Source Dataset Name	Combined Assembly of Wetland Metatranscriptomes
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1187
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location
Location Name	Twitchell Island, Sacramento and San Joaquin Delta, California, USA
Coordinates	Lat. (^o)	38.107	Long. (^o)	-121.6475	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067889	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151652_130347222	F067889	GGAG	MDNKEEDVRKLIAAAAILAVVFVIGCQDTKKVTELQGQVDKLTQQVTELTGQLQQMTVQKDSVAKVLAELQAKMPPAKGGTTKPPAAKGGGGAVKPPTKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.