NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153933_1087006

Scaffold Ga0153933_1087006


Overview

Basic Information
Taxon OID3300011411 Open in IMG/M
Scaffold IDGa0153933_1087006 Open in IMG/M
Source Dataset NameAttine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)662
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: New Jersey, Wharton State Forest
CoordinatesLat. (o)39.778Long. (o)-74.6307Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001133Metagenome / Metatranscriptome767Y
F026357Metagenome / Metatranscriptome198Y

Sequences

Protein IDFamilyRBSSequence
Ga0153933_10870061F001133GAGGMWIDKLLDGVLEVETPIGRRFVQPNLAERAYLIWTFRNFFSLPQQVLRPWERRLVDRLWAENRFVSVRSNGTPEAPVIGRVERRAHLQAEVVQINNESMRKPAVSSTSPASEQGHEAA
Ga0153933_10870062F026357N/AIMLPPGIGLGSGGWTLCEASVVRVEESDGKGIGIAATLDRVALLPEIS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.