NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137463_1076821

Scaffold Ga0137463_1076821


Overview

Basic Information
Taxon OID3300011444 Open in IMG/M
Scaffold IDGa0137463_1076821 Open in IMG/M
Source Dataset NameSoil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1252
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9776Long. (o)-107.0024Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002523Metagenome / Metatranscriptome552Y
F008095Metagenome / Metatranscriptome339Y
F011883Metagenome / Metatranscriptome286Y

Sequences

Protein IDFamilyRBSSequence
Ga0137463_10768211F002523GGAMLVIVSVSRLDDDQVEIRVAKPQHDSNCAQVYPSEKEVRAVLSGLGISHDVIDLHLKLLPQVSANEPLKFPPTDVPRHELLSRGFRL*
Ga0137463_10768212F008095GGAGMENSKDQDRGKGAVEEDKQSQGGNTSMQGQLGHRDEDVELKNADSNLAG*
Ga0137463_10768213F011883N/AYHISERIASLKNEMSELRVTNALSCYRKGTLEKSASALRQRRLVEIKLELADLMKRCA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.