NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119781_103305

Scaffold Ga0119781_103305


Overview

Basic Information
Taxon OID3300011967 Open in IMG/M
Scaffold IDGa0119781_103305 Open in IMG/M
Source Dataset NameHuman oral microbial communities from Los Angeles, CA, USA - S03-01-D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Los Angeles
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3409
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral → Human Oral Microbial Communities From Los Angeles, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: Los Angeles
CoordinatesLat. (o)34.0722Long. (o)-118.4441Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040149Metagenome162N
F055792Metagenome138N

Sequences

Protein IDFamilyRBSSequence
Ga0119781_1033053F055792GAGGMEIASQALDSTSAVTHRILLLTTQLGESLLASFGAEDGVIAEAMVTRALESNLSIDSTLEEVGPVLIDKGDDGTEAGTTWGRYPLETLQKEGYILFEGRMLPCEACGVDPRSSVKSLDLESRIIGEAIEPVALPHVARLDEGIPLQRIGGLRDLLVTPDVSQADDL*
Ga0119781_1033054F040149GAGGVADEGAKEFRWKVLIKEQGIPVLFVEVEAWYDGRVSSSEILSSFGIALEREPRLTPVWHHDSEDAIHDFIYDISVPKGHALTAVRERETVVMQLLNIHRMF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.