Basic Information | |
---|---|
Taxon OID | 3300011992 Open in IMG/M |
Scaffold ID | Ga0120146_1016106 Open in IMG/M |
Source Dataset Name | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Tennessee |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1461 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Axel Heiberg Island, Nunavut | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | .65 | Location on Map | ||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034274 | Metagenome | 175 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0120146_10161061 | F034274 | N/A | DDIEVAATKDGTITALRLKITANLGAYHQLLTPVIPTLTTSATDATVGGTISVSRNNASGKTIVSGDPSAGRTQLVQQPNGAIQLYFPSAQGAARMTSTDDGQTWTGPIQTQSHTTGPVQAAVAPDGTPYFSQDSTAGVNVFRGLNGESVKNVFPRCCGYAESLAVDTTGLVQVAFYSNADPDGTFLYEKLGADLSPADSTPLKPTGIHFDRVPLVADHSGTTFMAWPPGDPATGVTVVPFRGGSPAGDGVDFRGSFVGGDPHMALTVDTKDELWIVWTGGGAVHAARSRSHGQHFGAAVSVPVTGTMYQVSAAGVAGNPGTVEVLVNTGSNLIQQALQPGLSVKVTRKVKKVGKKKIVTRVAQALDDGFGVPTAIFRIGGRAIHANSAGTAKVPAGAGKVTAPGYVVASFHAR* |
⦗Top⦘ |