NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153799_1012562

Scaffold Ga0153799_1012562


Overview

Basic Information
Taxon OID3300012012 Open in IMG/M
Scaffold IDGa0153799_1012562 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1823
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location NameOntario, Canada
CoordinatesLat. (o)42.581667Long. (o)-79.9225Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000450Metagenome / Metatranscriptome1126Y
F005504Metagenome / Metatranscriptome398Y
F071228Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0153799_10125621F005504N/ALVPNCLLTLEYEEETGWGGEYEIVRGEVKENLEYTNRCYACDSCDTMDYCDNECGEFCSSCNEGSWKDEEAMAECQTHKIYLTTTETKGN*
Ga0153799_10125622F071228AGGAMETPYGATVTPAVPATYNPSALVQYKVIQGEDVTYPISKVTDLEWDLQQGRTNRESLDNLKSTVRELEELLIELYNPNYTKEEALKQIAELFGFELSKSVTVTGTINFEVIVQVPLDEIEDFDAHYKLGDELSLTSYGSDVEVNDWSIESTDVDWD*
Ga0153799_10125626F000450AGGCGGMGDRANFGFVQPNGQTIVLYGHWAGHQMLGKLADAVIAARPRWNDSSYATRIAISNIIADQWNMETGWGLYVNEIGDNEHKIAIIDWDQQTFSLHEWADGRDPLNKVRGMNNKALFTMDLTSFCEKYALDKLLVV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.