Scaffold Ga0119867_1000801

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119867_1000801

Scaffold Ga0119867_1000801

Overview

Basic Information
Taxon OID	3300012018 Open in IMG/M
Scaffold ID	Ga0119867_1000801 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Tongji University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	16355
Total Scaffold Genes	21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (28.57%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Shanghai, China

Source Dataset Sampling Location
Location Name	China: Quyang, Shanghai
Coordinates	Lat. (^o)	31.3	Long. (^o)	121.5	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046201	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119867_100080119	F046201	AGG	LPHEFYDLEFDEYLLMRKGYIDKMRDEAYLLRFQTALIVEAQIGKGQGVRYVMESWKLEEEPEISSEDVKALLKKKKEAQYLKRLKNGRGAEDTNRG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.