Scaffold Ga0119869_1020644

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119869_1020644

Scaffold Ga0119869_1020644

Overview

Basic Information
Taxon OID	3300012020 Open in IMG/M
Scaffold ID	Ga0119869_1020644 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - Activated sludge
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Tongji University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2304
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (88.89%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Shanghai, China

Source Dataset Sampling Location
Location Name	China: Quyang, Shanghai
Coordinates	Lat. (^o)	31.3	Long. (^o)	121.5	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098921	Metagenome / Metatranscriptome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119869_10206447	F098921	GAGG	MSTPDPALTAALKAMLTDACWRCSDGDGATCDPCLSELVAAAERDAEARTVMTSLRGMFDPMTGRPAGGGW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.