NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153991_1072046

Scaffold Ga0153991_1072046


Overview

Basic Information
Taxon OID3300012059 Open in IMG/M
Scaffold IDGa0153991_1072046 Open in IMG/M
Source Dataset NameAttine ant fungus gardens microbial communities from North Carolina, USA - TSNC075 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)531
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: North Carolina, Jones Lake State Park
CoordinatesLat. (o)34.5814Long. (o)-78.4485Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032492Metagenome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0153991_10720461F032492N/AEAVQVIVHCPVSLVVRGAFQGINGICFCVDRKELTPELLFEISPGLDRKNAGVRLLAKEVLRPPRCTSVFEKGESPKDFLLIAAELLRSQA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.