NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0154000_1049460

Scaffold Ga0154000_1049460


Overview

Basic Information
Taxon OID3300012083 Open in IMG/M
Scaffold IDGa0154000_1049460 Open in IMG/M
Source Dataset NameAttine ant fungus gardens microbial communities from North Carolina, USA - TSNC084 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1022
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: North Carolina, Lumber River State Park
CoordinatesLat. (o)34.9174Long. (o)-79.3535Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F104168Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0154000_10494601F104168N/AMMSEKDILSDDKKKTPADCQGRRSRE*LIERPWLQLMCCVPVSGCEVGHVFRSSGSRRDRGPKWSSGGVREDKM*LGPDDVNLQTEELHYNYLVLIGSLE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.