NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153996_1004867

Scaffold Ga0153996_1004867


Overview

Basic Information
Taxon OID3300012144 Open in IMG/M
Scaffold IDGa0153996_1004867 Open in IMG/M
Source Dataset NameAttine ant fungus gardens microbial communities from North Carolina, USA - TSNC080 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4377
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Phallomycetidae → Geastrales → Sphaerobolaceae → Sphaerobolus → Sphaerobolus stellatus → Sphaerobolus stellatus SS14(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: North Carolina, Lumber River State Park
CoordinatesLat. (o)34.917Long. (o)-79.3533Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000383Metagenome1208Y
F002648Metagenome539Y

Sequences

Protein IDFamilyRBSSequence
Ga0153996_10048675F002648N/ALKKARVQKIFSSSQVNCSGARHKYSMQELRKAHPELRLPEKSGGEGSFGLIRCLDGAAGTGEGGLTGGRDRGIRGRVTVGTGAVMS*
Ga0153996_10048678F000383N/AFASRGTSVHLHFSGLPIDLRVVVLEPGITEDHALFSKAGDSEERPFGVGFVTENHVYHFRDLTCLVGGAIHIVHQYGARDALGVNAFRSDKVSIYEVAHSSRVQKRLDGMHLAGVGGTDFYQEDDQRSVGVKGVDGESFG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.