Basic Information | |
---|---|
Taxon OID | 3300012151 Open in IMG/M |
Scaffold ID | Ga0153938_1019610 Open in IMG/M |
Source Dataset Name | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ022 MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1587 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Boletales → Coniophorineae → Serpulaceae → Serpula → Serpula lacrymans | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA:New Jersey: Brendan T. Byrne State Forest | |||||||
Coordinates | Lat. (o) | 39.8727 | Long. (o) | -74.5215 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058580 | Metagenome | 134 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0153938_10196101 | F058580 | GAG | MVFTIEPILAIPEINREMRVEADASDYATGGVLSMKC |
⦗Top⦘ |