Scaffold Ga0137465_1000099

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137465_1000099

Scaffold Ga0137465_1000099

Overview

Basic Information
Taxon OID	3300012231 Open in IMG/M
Scaffold ID	Ga0137465_1000099 Open in IMG/M
Source Dataset Name	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	70858
Total Scaffold Genes	73 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	38 (52.05%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location Name	USA: East River, Colorado
Coordinates	Lat. (^o)	38.9778	Long. (^o)	-107.0022	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004923	Metagenome / Metatranscriptome	418	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137465_10000992	F004923	AGGA	MLLLAQDEGVRTADVPNAMGAHTWFIIVVLGAFLLWCISYSLQLHKEALARRKGREDLLRRKDELIDRIAALETQNDSGEISEKKYKQELKDLKFQLAKALEKLAHERQTRTSG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.