NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136715_1036335

Scaffold Ga0136715_1036335


Overview

Basic Information
Taxon OID3300012264 Open in IMG/M
Scaffold IDGa0136715_1036335 Open in IMG/M
Source Dataset NameFreshwater sediment bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - Sed-PBS metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)547
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: Indian Creek, Illinois
CoordinatesLat. (o)41.6655Long. (o)-87.5437Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074546Metagenome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0136715_10363351F074546N/AKKLTPDEKEAFRLGVMADVNERLGNFKGGDFTKQIFKSENQKLLLRNAFPDQASYNEFSQYVKGLNRQAETKQRVLGGSRTDENKAVREESSLLGSLAQASASGDLVSLLRSGVSALQSRAKGISSESSEALQKRLFTVDPIEQTAILRELNKRAQRPQTGLLTGAAAVGSATGIIGD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.