NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136586_1058931

Scaffold Ga0136586_1058931


Overview

Basic Information
Taxon OID3300012272 Open in IMG/M
Scaffold IDGa0136586_1058931 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #562
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)880
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Rauer Islands
CoordinatesLat. (o)-68.5558Long. (o)78.1913Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009588Metagenome / Metatranscriptome315Y
F021246Metagenome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0136586_10589311F009588N/AMSSQIQADFLRLLWVLADKQLRSYYESMGKEDKIGNEAFQWARAKVFNYNKTSVGRAIAFGCTTRCHLSVNSL
Ga0136586_10589312F021246AGGAMTHTVIPPPRCTADTLELTNNGNINDKTIPERDREVRDFNVTLLASAISRRRNLVIDTHRTDLGVTRQGCHYIHEMIVTVNRTCVLLASKDMITQRIDTHLAGAERATVSVGKHLGDGHCETPAEKSLPNIRRETSLKLIRGKV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.