NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157136_1002297

Scaffold Ga0157136_1002297


Overview

Basic Information
Taxon OID3300012282 Open in IMG/M
Scaffold IDGa0157136_1002297 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Central Basin Methane Hotpot in Lake Erie, Ontario, Canada - Station 1365 - Bottom - Depth 20.5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1462
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location NameOntario, Canada
CoordinatesLat. (o)42.097417Long. (o)-82.141111Alt. (m)Depth (m)20.5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013634Metagenome / Metatranscriptome269Y
F031456Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0157136_10022971F031456N/ASAAAVFNLDFLPEKFLVVATGASQALSNFSVVTAGVQLMSITALARINALARFDSGTILDGAAPANQQAAAYLRLATGRINKGTTITGTNSVAAVRNVFAASTNISNVARRAVEQSINPSANATFDSFEALLFDPANLLRAQITFANGYTDEYTPQELQALYANYHVAEADGNVNGLTIIDADSGAGLISQVTLFAGAGAAIVVLKTDYVQL*
Ga0157136_10022972F013634N/AMAIPLAAIGAGLGALQQSKIEKALAGEKTYTKPKTIFGKLIGGVSGRTAAAEASQTKTSPLSENVMNSLQPNERAKTPVSGGFSFGGEASKKTYLPFAIVAAIVAAFYFMRRKGGRRRR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.