Scaffold Ga0157136_1012400

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0157136_1012400

Scaffold Ga0157136_1012400

Overview

Basic Information
Taxon OID	3300012282 Open in IMG/M
Scaffold ID	Ga0157136_1012400 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Central Basin Methane Hotpot in Lake Erie, Ontario, Canada - Station 1365 - Bottom - Depth 20.5m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Molecular Research LP (MR DNA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	507
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location Name	Ontario, Canada
Coordinates	Lat. (^o)	42.097417	Long. (^o)	-82.141111	Alt. (m)		Depth (m)	20.5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004838	Metagenome / Metatranscriptome	421	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157136_10124001	F004838	N/A	TDISGQIFTSASRHQNPSVTNLTQNEFEVNEALLVETIAFYVKNEAGNVENFQAVYGSNAVIVFDLVIGNKRVMKSTPVFAAGSPYTFANSGNFNNITGETQIQVFAPRHQVFMEGAGVLIPPQVQWYVDYRIFDVVTGATIAATDDTAIGCYLFGTRVLLNFNTSI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.