NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157139_1000254

Scaffold Ga0157139_1000254


Overview

Basic Information
Taxon OID3300012345 Open in IMG/M
Scaffold IDGa0157139_1000254 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Burnt River, Ontario, Canada - S22
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2021
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameKawartha Lakes, Ontario
CoordinatesLat. (o)44.74057Long. (o)-78.6591Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000324Metagenome / Metatranscriptome1299Y
F011148Metagenome / Metatranscriptome294Y

Sequences

Protein IDFamilyRBSSequence
Ga0157139_10002541F000324N/ANETTLLVFHAAQGEGLPRHGHEYEHLTMCHAGSIIVRKEGKELVMTKDTQPVNLVAGEWHEIEALEDGTVFVNVFAENKS*
Ga0157139_10002542F011148GGAVAVFNKNSITQVSGFNNPCITGELVYQQKTYWNLVLTSEDGTTPVNLTGATINAQIVRRTLTNVQDTRYGLSFDIGNYTPTPTAIPLTISNRVDATGAFTLVIDDSSWSLVDTDAEMAINSATGAGFSGRIKISFPTSGSTPAEDNIIFLLFIVRSDGIVKV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.