NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157141_1000550

Scaffold Ga0157141_1000550


Overview

Basic Information
Taxon OID3300012346 Open in IMG/M
Scaffold IDGa0157141_1000550 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Emily Creek, Ontario, Canada - S29
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10748
Total Scaffold Genes27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (77.78%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameKawartha Lake, Ontario
CoordinatesLat. (o)44.46181Long. (o)-78.6228Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F001176Metagenome / Metatranscriptome756Y
F042904Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0157141_100055010F042904GGCGGMDNKQTVLEGIIEDVATDLYNKWVAAMPEEDKNEIAFQALSKNAHETTLFVVQNFMNKFNDAAEALKGD*
Ga0157141_10005502F000473AGAAGMFIDKSLDKQKEHFKYGINQWTGEPNKPVFYTDEMKKKVRELKQPMFLLMDIVMYPDFLAIRLYEDNFVQFDGIEKEKVIDYVSKVKHLLESYGVRCEMEGVPSERVV*
Ga0157141_100055020F001176GGAMSENGTGMASPGNSEASGALTSREATAKSPSQGKFRSGFAGPKPAIKVDTNKHGIRREVNLNPPKKTSGKKK*
Ga0157141_10005504F000671GAGGMDKILCYSCNKSKNKLSVKKSALLPINLFLCETCLTAKLEPRWVVILSGRQNGIDSVKDAILKRRYLGEEISAQELMI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.