NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157138_1000921

Scaffold Ga0157138_1000921


Overview

Basic Information
Taxon OID3300012352 Open in IMG/M
Scaffold IDGa0157138_1000921 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Baxter Creek, Ontario, Canada - S37
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5421
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (64.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameFraserville, Ontario
CoordinatesLat. (o)44.16961Long. (o)-78.4089Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F008814Metagenome / Metatranscriptome327Y
F011394Metagenome / Metatranscriptome291Y

Sequences

Protein IDFamilyRBSSequence
Ga0157138_100092111F011394GAGMANFIDKDKDHFKYGINEWTGEANKAVFYTKEMAKKVRELKSPAHDLQMDIVKYPDFLAIRLYENNFSQYDGSMKMRVIDYIEMVKKILESYGVRVELEGKPGGRTR*
Ga0157138_10009213F008814GGAMADVTVLDGIIKDLGQELYQKWYNSLAEEDRTPEASEAMSKNAGETTFWVIQNFMIRFNDAAEALKDKE*
Ga0157138_10009219F000671GGAMEKVLCYCCNKSKANLNVKRSSLLPINLLMCETCISSKFEPRWTIILSGRQYGHETVKDYIAKKKYVGEDIKASELLV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.