Scaffold Ga0137369_10271910

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137369_10271910

Scaffold Ga0137369_10271910

Overview

Basic Information
Taxon OID	3300012355 Open in IMG/M
Scaffold ID	Ga0137369_10271910 Open in IMG/M
Source Dataset Name	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1270
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	39.5673	Long. (^o)	-123.4758	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024280	Metagenome	206	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0137369_102719101	F024280	N/A	ILCLMALISIEGRKHKPKCAICEGEPVETVTTSAWRFTLCPDHVTKFAARRLADAERVLLLQKKQPAGAAWQPAFCALCVDPADLIFTEKEGTFAFCQPHFIRYVLLALRPNEYSVFSGRLTPEQFLTRLSSKYYFEGMAEQAYFEDLDDPAYAVATPLWET*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.