NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134033_1160240

Scaffold Ga0134033_1160240


Overview

Basic Information
Taxon OID3300012383 Open in IMG/M
Scaffold IDGa0134033_1160240 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1175
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: Angelo Coastal Reserve, California
CoordinatesLat. (o)39.7181Long. (o)-123.6527Alt. (m)Depth (m).2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005635Metagenome / Metatranscriptome394Y
F025526Metagenome / Metatranscriptome201Y

Sequences

Protein IDFamilyRBSSequence
Ga0134033_11602402F005635GGAGMAYRNKIYLIICGIVAQLLFFGDLRADELRPRDNATEQEISTAPEHHDMTLVSSQPWVVEGEVLGTLAAYVYSDVTTERPVDYWELYDKQTNLLAVSWFDRFGIQRTAVDRGVVEEEDKLEGIFVVVLDGNLI*
Ga0134033_11602403F025526GGAGGMETGVKLNVTKTIRSSKTGLLLPREGTLVSVTENLGRTLLLVEFEGGQHEYLFEYEVEFENGNRSRQKYGAGANAHV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.