Scaffold Ga0138259_1541283

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138259_1541283

Scaffold Ga0138259_1541283

Overview

Basic Information
Taxon OID	3300012416 Open in IMG/M
Scaffold ID	Ga0138259_1541283 Open in IMG/M
Source Dataset Name	Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	664
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Euglenida → Spirocuta → Euglenophyceae → Eutreptiales → Eutreptiella → Eutreptiella gymnastica	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine → Polar Marine Prokaryotic And Eukaryotic Communities From Antarctica During Spring Seasonal Transition

Source Dataset Sampling Location
Location Name	Antarctica
Coordinates	Lat. (^o)	-64.775	Long. (^o)	-64.053	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004926	Metagenome / Metatranscriptome	418	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138259_15412831	F004926	N/A	KWTGRQIDMFAAAGQQLHALRMKNPGQGKDWTSEAIWAHVKTINSVFATRGMDLPIVYIHNHDFNGMGGHIGAAAFRLAQKEGFSNLVIDAAYRKNGTHNDNTVLTDALSLTKEQGEALIEYGHIQQQIEQVLCRFDSRNSQMTPWDSDWAGGTEGSDIRICKEFDINPRLINHAKEVATEVFPLERAVTPFSEYKLRLGIGIMIEAGIQPKSADAVRAWV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.