Scaffold Ga0138256_11157451

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138256_11157451

Scaffold Ga0138256_11157451

Overview

Basic Information
Taxon OID	3300012533 Open in IMG/M
Scaffold ID	Ga0138256_11157451 Open in IMG/M
Source Dataset Name	Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	576
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → unclassified Phyllobacteriaceae → Phyllobacteriaceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria

Source Dataset Sampling Location
Location Name	Austria: Klosterneuburg
Coordinates	Lat. (^o)	48.3	Long. (^o)	16.2	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093756	Metagenome / Metatranscriptome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0138256_111574512	F093756	GGA	MRHTPALRLRDCQPGQAVHLRGPKGYPFVSIDGHVRLHYGERGDQYGKLWLSMEDHAAGKPWAVMACLGSEVRHA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.