NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157203_1005719

Scaffold Ga0157203_1005719


Overview

Basic Information
Taxon OID3300012663 Open in IMG/M
Scaffold IDGa0157203_1005719 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Indian River, Ontario, Canada - S50
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2344
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameWarsaw, Ontario
CoordinatesLat. (o)44.42735Long. (o)-78.1359Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009462Metagenome / Metatranscriptome317Y
F024559Metagenome / Metatranscriptome205Y
F043407Metagenome / Metatranscriptome156Y

Sequences

Protein IDFamilyRBSSequence
Ga0157203_10057193F043407GGAMSHTYTISNTTANTGNLTLTSGGTSISGYGAIPSLSASQVYTINTGAVSGGVIGGSGQIYTTTGTNGASWHNPADTVMKINQSPPELEVKGRMVINGIDLEERLKTIEKVLQIPERDVKLEKKHPKLKKLYDEYINALGKYRTFDAIKGDE*
Ga0157203_10057194F009462AGGAGMMELHESVRDTYKEMVIKEHEGFRLTLKKHEVLMPKGLFSIDMVQESLKDGEVVESQVYNFFMTKEECQALAYGLTA*
Ga0157203_10057196F024559GGAGGMIKSLIKLILGITLLLAVIVFGPLLGIWSLNILFPVLNIPYTWETWAAYFLVFGSLTGLRIGSRRKE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.