NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157208_10003773

Scaffold Ga0157208_10003773


Overview

Basic Information
Taxon OID3300012667 Open in IMG/M
Scaffold IDGa0157208_10003773 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Maskinonge River, Ontario, Canada - S15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2624
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameKeswick, Ontario
CoordinatesLat. (o)44.22385Long. (o)-79.4212Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000441Metagenome / Metatranscriptome1136Y
F000852Metagenome / Metatranscriptome860Y
F001507Metagenome / Metatranscriptome681Y
F031497Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0157208_100037732F001507AGGMDTKPYAIHELVTAIYEDNFSHFDFMDNMGGGDCDCNLHQTMNVIAAYEEGLVDGPWEEHL*
Ga0157208_100037736F000441AGGAGGMSDQFINEQLNKAQQLLWGGSETENIEAHNIIAKLIKDRVEQADLI*
Ga0157208_100037737F000852GGAMATKREYLKQQGITVGVRGRFSGAAKVALAEAESKGITFTAEAPVKKAK*
Ga0157208_100037738F031497GGAGGMKTPETKVAESLVNLMDDHWFNPTMFGRYLAEQPLHTIDRVMEMVVSVISEQAKMYDLYLNRGTSSEGLMLANELNECIKAYQESNQLNNLKLPSRSYKVKREEVKQHTFGWREEEDPFSQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.