 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300012667 Open in IMG/M |
| Scaffold ID | Ga0157208_10005579 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1991 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Keswick, Ontario | |||||||
| Coordinates | Lat. (o) | 44.22385 | Long. (o) | -79.4212 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054559 | Metagenome | 139 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157208_100055795 | F054559 | AGG | MKIGFSFGRCIRDIVNGEINIGDVAWIISGTAMRDADAARAVIEDYLYRQDYLYGLDEDKCYEVGMKLYEGGKVLQPRLEGVYRHMIPEGALWADMFPTNMANNQAAKSAWDAYRLMIHMTTQVPENVEEHWKGDGNVN* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |