NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136616_10008450

Scaffold Ga0136616_10008450


Overview

Basic Information
Taxon OID3300012679 Open in IMG/M
Scaffold IDGa0136616_10008450 Open in IMG/M
Source Dataset NamePolar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5341
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location
Location NameAntarctica: Dry Valley
CoordinatesLat. (o)-78.0577Long. (o)163.7401Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022367Metagenome / Metatranscriptome214Y
F058753Metagenome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0136616_100084502F022367GAGMRILISYEESYHLYSDALQRALSSLRPDAEVAACRLSVIGEQVESFNPNLVVSSRPNTVDPGGRVAWYELSPEPDEPSEACLGGRRWQRPNPTLEELLSFIDEVEALLRREREPRGC*
Ga0136616_100084509F058753GGAGGMQASTNIRRTPERREGRRKLLAVAAALVMAVAALLLTLALSSSIGPSNAAVQKELPYTFFFTHYQLLGDPNNPDGVRYHSNGKPSAKAPNGSEVTLSGKGGWNPKNDIAKGGGHYTIKGSSGAVKAQGSWRVTGFRSFEQFSGWWGMGPDFKEKGWQGPPGSASFSGFLTLRVSLENQGEGTLVAWCLMP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.