NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136612_10005250

Scaffold Ga0136612_10005250


Overview

Basic Information
Taxon OID3300012680 Open in IMG/M
Scaffold IDGa0136612_10005250 Open in IMG/M
Source Dataset NamePolar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6195
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location
Location NameAntarctica: Dry Valley
CoordinatesLat. (o)-78.0456Long. (o)164.0158Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036582Metagenome / Metatranscriptome169Y
F054147Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0136612_100052507F036582GGAGMISRPHAAIAETLRGIALWRRAKAEEYDRDARNLRTAAALEELADHILTLPEDDPRVQALHRVAFETDSFVPGQQALYELGRFRFHHPDVGLDAFLDRIVELAIADRGEHGHFGGQLPEGDDPWE*
Ga0136612_100052508F054147AGGAGMTGSQGGKAGERYDPAGERGGDTGPSAGPTKGPQAEKGDQRRANPVHSGPTRPSTQNNDCKHDKRSGSDSNASR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.