NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157543_1088565

Scaffold Ga0157543_1088565


Overview

Basic Information
Taxon OID3300012687 Open in IMG/M
Scaffold IDGa0157543_1088565 Open in IMG/M
Source Dataset NameOligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES032 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5359
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.008Long. (o)-89.701Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047677Metagenome / Metatranscriptome149N
F070109Metagenome / Metatranscriptome123Y
F084221Metagenome / Metatranscriptome112N

Sequences

Protein IDFamilyRBSSequence
Ga0157543_10885652F070109N/AMKLTSVLLILLIGTALSVPCTTYSQALPPKDTLVSLTTEQVRSLLKLKAERDYLKVQVGLLSKSDSIASFVIKDQQKSIDAYTIANEQKAQQLVKVQQELYKEAARKESWRSAALIGIPISFVGGIIFNLLF*
Ga0157543_10885653F047677N/AMKWLKSIFSNEKDASSKRVASILALLVCINLSYIGTFTEYKTPEYMFNGLLILAGGGLGLTVIESIFDKKKSNDTGSQDTN*
Ga0157543_10885654F084221N/AMSNHQQQVAEGVTGAVSSILLSVPAWMVDVEFALKIFCLILSAAASIFTIYKMRKKR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.