NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157623_1107691

Scaffold Ga0157623_1107691


Overview

Basic Information
Taxon OID3300012707 Open in IMG/M
Scaffold IDGa0157623_1107691 Open in IMG/M
Source Dataset NameEutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2043
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.099Long. (o)-89.405Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000710Metagenome / Metatranscriptome925Y
F002259Metagenome / Metatranscriptome577Y

Sequences

Protein IDFamilyRBSSequence
Ga0157623_11076912F002259N/AMGMSAQDKMINVASRLGLTSLKDMQGTTRMVYDSIPTAATNFTFFKGAAQRAFPLTNVGANGNQFQVNEALLVEKIGFFIPNSDAGTSYAGLGTNSVKFDLVIGNKTVLKDVSCEFGGEQAFWNDGTVGSSVIDLEGVGILIPPQVEYYVIAKPFATGARTATSIRLGCYLFGTGALLNFNTTI*
Ga0157623_11076914F000710N/AMATNMNISYRQGIRNKGFQVTVPTTGATQTLSLSGLAKAFEGIIFSSSTSAAPATLVNALQLRVTLTINNDVVIDDVVAHDLGASATSGITSGFPNFIPFPRALTGQDTILLRVTNSSGASQLLNATVYYKN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.