Scaffold Ga0138269_1255535

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138269_1255535

Scaffold Ga0138269_1255535

Overview

Basic Information
Taxon OID	3300012778 Open in IMG/M
Scaffold ID	Ga0138269_1255535 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	536
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location Name	Canada: Quebec
Coordinates	Lat. (^o)	46.8319	Long. (^o)	-72.5	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023788	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138269_12555351	F023788	N/A	LMKNTLRRIRLFFVRLSQHLSEMLYVPSQTGSHDVEEQYMGDVASTYVDHKNFPEVARSPFRGVVIPKRV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.