Basic Information | |
---|---|
Taxon OID | 3300012879 Open in IMG/M |
Scaffold ID | Ga0160504_1009543 Open in IMG/M |
Source Dataset Name | Enriched soil microbial communities from UW Madison campus, WI, USA - DID2937_E24_Xylan MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2660 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Madison, Wisconsin | |||||||
Coordinates | Lat. (o) | 43.073 | Long. (o) | -89.4011 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F096377 | Metagenome / Metatranscriptome | 104 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0160504_10095431 | F096377 | N/A | RWKSFNVTHHKVAGKDRKYIKINNNGDLVQFQSKYKSTPLYFIPTDDNNVNVFITDNGNKTFLIEDFLIQIVDAIISDILGQEDIIEDVVSKLFAKLERNPTPFQEDLWLPIFSIKEKAIDLEAAKSLLKDEYKVNYATNTCTIGLNGSRVPGNLKVRPSEKSKILEKPFLFGKFSFIKIFFSNIS* |
⦗Top⦘ |