NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0160504_1009543

Scaffold Ga0160504_1009543


Overview

Basic Information
Taxon OID3300012879 Open in IMG/M
Scaffold IDGa0160504_1009543 Open in IMG/M
Source Dataset NameEnriched soil microbial communities from UW Madison campus, WI, USA - DID2937_E24_Xylan MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2660
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location
Location NameUSA: Madison, Wisconsin
CoordinatesLat. (o)43.073Long. (o)-89.4011Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096377Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0160504_10095431F096377N/ARWKSFNVTHHKVAGKDRKYIKINNNGDLVQFQSKYKSTPLYFIPTDDNNVNVFITDNGNKTFLIEDFLIQIVDAIISDILGQEDIIEDVVSKLFAKLERNPTPFQEDLWLPIFSIKEKAIDLEAAKSLLKDEYKVNYATNTCTIGLNGSRVPGNLKVRPSEKSKILEKPFLFGKFSFIKIFFSNIS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.