Scaffold Ga0160425_1000052

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0160425_1000052

Scaffold Ga0160425_1000052

Overview

Basic Information
Taxon OID	3300012886 Open in IMG/M
Scaffold ID	Ga0160425_1000052 Open in IMG/M
Source Dataset Name	Microbial communities from bioreactor (seeded with sewage sludge) at Lawrence Berkeley National Lab, California, USA - Biofuel Metagenome 8 (Illumina Assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	193616
Total Scaffold Genes	168 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	112 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa

Source Dataset Sampling Location
Location Name	USA: Berkeley, California
Coordinates	Lat. (^o)	37.82	Long. (^o)	-122.29	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011098	Metagenome / Metatranscriptome	295	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0160425_1000052102	F011098	N/A	VRRASLGRAIAESVVPGLTCLVLAAAVITALGWWFHAHYALSWQSPVAVHFQLPFVLAERTVSEGALQAQADQQGRGLTAWQQYACRKFGPDCRVALAIQRAENAAGKCEIYHYNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLFREKGGFTPWSTYKDGRYLRYMGVNR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.