Scaffold Ga0160429_1245358

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0160429_1245358

Scaffold Ga0160429_1245358

Overview

Basic Information
Taxon OID	3300012888 Open in IMG/M
Scaffold ID	Ga0160429_1245358 Open in IMG/M
Source Dataset Name	Solar panel surface microbial communities from Lawrence Berkeley National Laboratory, California, USA - R
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	598
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Solar Panel → Unclassified → Unclassified → Solar Cell Surface → Solar Panel Surface Microbial Communities From Lawrence Berkeley National Laboratory, California, Usa

Source Dataset Sampling Location
Location Name	USA: Building 30, Lawrence Berkeley National Lab, Berkeley, California
Coordinates	Lat. (^o)	37.876387	Long. (^o)	-122.246777	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059667	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0160429_12453582	F059667	N/A	MCIKAKAANTKGSTKCKAKNLFKVALLTEKPPHINSTISCPTQGIALIRLVITVAPHNDICPYGKT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.