NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0160423_10013522

Scaffold Ga0160423_10013522


Overview

Basic Information
Taxon OID3300012920 Open in IMG/M
Scaffold IDGa0160423_10013522 Open in IMG/M
Source Dataset NameMarine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6280
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (44.44%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location
Location NameCosta Rica: the Eastern Pacific
CoordinatesLat. (o)8.7051Long. (o)-86.4906Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033826Metagenome / Metatranscriptome176Y
F051947Metagenome / Metatranscriptome143Y
F089555Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0160423_100135222F051947N/AMGIKKVGVRHHDSMKFPPDGEIIFREWAVNNTPITNVCSTRVATRLPRNATLPFLTFFVSGGTMNNQAGDAAIGAITIQLNAYAGRWGSGTSSQPDYATAYKLANAVAESAFKTAKTIVHTTTTSTKAVIYGFDIAEMPARVEETDTGLGHYELSLIMYYRGLD*
Ga0160423_100135224F089555N/AMPLRHKLLPEIATIQTVTDSNVDERGLPSDNWSNTYTNVKAKFISAGAEEDREGRNTTIETFNVYLEKGVIVTAGDRLKRGSEFHEIVMVQPVLDRYGVECYKLLQTFVSK*
Ga0160423_100135228F033826GAGMALCSVSDVEQFLQVDLNSTVEASVTNTFIPYVDSAIKRFLGYDVETATHTEVFDGNEQQDLFLRHIPIASITSVTEDGNTLTQGNEDDYVFYDNGRLRRIVVRWSGIKPKNITVTYVGGYAANDIPAVIKNTSAKAAARMLMTSLQIGSKADTGQVGSHLSDNTASSTFDIPITERIGDYDVAYADVVIQNLTPVLTQGDMLILNPFKSRFFV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.