Scaffold Ga0164290_1000172

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0164290_1000172

Scaffold Ga0164290_1000172

Overview

Basic Information
Taxon OID	3300012921 Open in IMG/M
Scaffold ID	Ga0164290_1000172 Open in IMG/M
Source Dataset Name	Contaminated culture microbial community from soil near Moab, Utah, USA - Microcoleus steenstrupii SON62 (Illumina Assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	241278
Total Scaffold Genes	217 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	41 (18.89%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium → Sediminibacterium goheungense	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Desert → Contaminated Culture → Genome Sequencing Of Microcoleus Cyanobacteria Isolates From Utah, Usa

Source Dataset Sampling Location
Location Name	USA: Moab, Utah
Coordinates	Lat. (^o)	38.5733	Long. (^o)	-109.5498	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021521	Metagenome / Metatranscriptome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164290_1000172110	F021521	N/A	VIPSRAKGEKMAGYSHRTAQPPILAAFLPWGGSAGAGRVRPAAAKVRVDTYFP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.