Scaffold Ga0163110_10600225

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0163110_10600225

Scaffold Ga0163110_10600225

Overview

Basic Information
Taxon OID	3300012928 Open in IMG/M
Scaffold ID	Ga0163110_10600225 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	850
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location
Location Name	Costa Rica: the Eastern Pacific
Coordinates	Lat. (^o)	2.0416	Long. (^o)	-97.0511	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032032	Metagenome	181	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163110_106002252	F032032	GAG	MKKNVISKKIIKVGNKHYTEEKYHPLFPSDRIITARTRKFTMEDFFNVGEFVLILLAGFFLLKIMFGFAHGMEAWAELDKLMRGY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.