Scaffold Ga0153915_10163498

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0153915_10163498

Scaffold Ga0153915_10163498

Overview

Basic Information
Taxon OID	3300012931 Open in IMG/M
Scaffold ID	Ga0153915_10163498 Open in IMG/M
Source Dataset Name	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2421
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Ryanbacteria → Candidatus Ryanbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_43_42	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls

Source Dataset Sampling Location
Location Name	USA: Ohio, Lake Erie, Old Woman Creek
Coordinates	Lat. (^o)	41.3778	Long. (^o)	-82.5108	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076450	Metagenome	118	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0153915_101634985	F076450	N/A	MRNDPQGRAIQIGRYLSAPLVLNVGVSSASVQLSQNRHYRLWPSVDMFFQFGAPGVTATTNSHPATGKLDYLHYTDDTNTTLAAVVGAGTGALFISEIDTQGV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.