NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157211_1000006

Scaffold Ga0157211_1000006


Overview

Basic Information
Taxon OID3300012933 Open in IMG/M
Scaffold IDGa0157211_1000006 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Tributary to Mariposa, Ontario, Canada - S7
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)102069
Total Scaffold Genes168 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)106 (63.10%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameKawartha Lakes, Ontario
CoordinatesLat. (o)44.33257Long. (o)-78.9405Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004133Metagenome / Metatranscriptome451Y
F015601Metagenome / Metatranscriptome253Y
F032284Metagenome / Metatranscriptome180Y
F073553Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0157211_1000006104F015601GGAGMAGYSRDFLIDAFMSRYIKCTLISIESLVRLEQMANDLYDRVGRDSFRTYASLDATALRVYKNSLE*
Ga0157211_100000645F032284N/AMTKDTYFEMCEMLNTPVVEADIPVEFDDFPLEVQQAFGVYRMLRDEWDTMNGNYLGKSLIGIADLLEAAEIEPQEKKFITMLVRLIDDVRSNEINKLKAQEPAK*
Ga0157211_100000671F073553AGGAGGMTDNEFFAQIQDDWFHEFVGAQRHEIFVCTNPQVENFEFDDIPF*
Ga0157211_100000673F004133AGGAGMKYTKEICDRLVADYQAGVPVHQLAQQLDLPERSIIAKLSSLGVYQKKSYVNKRGEIPVKKSEHIERIATLLDCDLELLESLEKVNKVVLKLIESRLSDPKSP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.