NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0162651_100014101

Scaffold Ga0162651_100014101


Overview

Basic Information
Taxon OID3300012938 Open in IMG/M
Scaffold IDGa0162651_100014101 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1022
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameRanch near Red Deer, Alberta, Canada
CoordinatesLat. (o)52.172047Long. (o)-113.738964Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002196Metagenome / Metatranscriptome584Y

Sequences

Protein IDFamilyRBSSequence
Ga0162651_1000141011F002196N/AEVHAERHGAWTFLPGTYLSFPEAAKCTGIRSDRQRYHDALVDLEYEGPSSGTRVRGTPGGTSTTSSPSAA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.