Scaffold Ga0164243_10274928

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0164243_10274928

Scaffold Ga0164243_10274928

Overview

Basic Information
Taxon OID	3300012940 Open in IMG/M
Scaffold ID	Ga0164243_10274928 Open in IMG/M
Source Dataset Name	Organic Plus compost microbial communities from Emeryville, California, USA - Original compost - Organic plus compost (OP)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1243
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location
Location Name	USA: Emeryville, California
Coordinates	Lat. (^o)	37.83	Long. (^o)	-122.29	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011022	Metagenome / Metatranscriptome	296	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164243_102749282	F011022	GGA	MSQSINEAKSELEAAQSALEAALRAWDESVSELWRTSLSLTQAQKRVTRAHELLRSALKAADE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.